PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP15520_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 276aa    MW: 30311.4 Da    PI: 9.0892
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP15520_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.5e-19124178256
                                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                    rk+ ++tkeq   Le+ F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_AchrUn_randomP15520_001 124 RKKLRLTKEQSALLEDRFKEHSTLTPKQKQALAKQLNLRPRQVEVWFQNRRARTK 178
                                    788899***********************************************98 PP

2HD-ZIP_I/II122.12.7e-39124213191
                    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerL 80 
                                    +kk+rl+keq++lLE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lk++y++l++en+rL
  GSMUA_AchrUn_randomP15520_001 124 RKKLRLTKEQSALLEDRFKEHSTLTPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKKCYETLTNENQRL 203
                                    69****************************************************************************** PP

                    HD-ZIP_I/II  81 ekeveeLreel 91 
                                    +ke +eL+ +l
  GSMUA_AchrUn_randomP15520_001 204 QKELQELK-AL 213
                                    *******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-18110174IPR009057Homeodomain-like
SuperFamilySSF466891.13E-18116181IPR009057Homeodomain-like
PROSITE profilePS5007117.815120180IPR001356Homeobox domain
SMARTSM003892.9E-16122184IPR001356Homeobox domain
PfamPF000463.6E-16124178IPR001356Homeobox domain
CDDcd000863.16E-17124181No hitNo description
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
SMARTSM003408.2E-23180223IPR003106Leucine zipper, homeobox-associated
PfamPF021838.7E-11180214IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MNPQDICDSG LSLGLGIGPT STASAEHRRR RKSISPCRNL IPDKPSLTLS LSDDVYGGLP  60
MPKAETNRAR EAPLSSPHSA ASAFSAAHEM NLKKEKDAGG EEVEVEVERV SSRGSDEEDN  120
SSARKKLRLT KEQSALLEDR FKEHSTLTPK QKQALAKQLN LRPRQVEVWF QNRRARTKLK  180
QTEVDCELLK KCYETLTNEN QRLQKELQEL KALKFAPPLY MQFPAATLTM CPSCERIGGG  240
GSSITDNSSK AGGAGPVVVP PKPGHFFNPF THSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172180RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009387114.10.0PREDICTED: homeobox-leucine zipper protein HOX19-like
SwissprotP466042e-81HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLM0U9G10.0M0U9G1_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP15520_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-60HD-ZIP family protein